PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco028201.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family FAR1
Protein Properties Length: 613aa    MW: 69380 Da    PI: 9.8342
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco028201.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1911.6e-2857146189
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk.tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                  +fYn+YA+++GF+ r+s+  +skr+++i++r++vCs+eg+r++++ + + +++r+r+ tr+gC+a+++vkk+++gkw +tk+e+ HnH l
  Aco028201.1  57 EFYNAYATQMGFKARISSFIRSKRDKTIISRQLVCSREGFRSTKDASiEGRTKRPRMITRVGCRAMIMVKKQSSGKWIITKCEKIHNHVL 146
                  6******************************************99997889999**********************************87 PP

2FAR197.41.6e-30210298290
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  fY+eYA++vGF+ r+s+ ++skr+++i++r  vCskeg+r++++++ e+ +r+ra tr+gCka+++vkk+++gkw+v+kl+++HnH+l 
  Aco028201.1 210 FYKEYARRVGFRARVSSYYRSKRDNSIISRLIVCSKEGFRAKKDENGEELQRPRAITRVGCKAMIMVKKRDSGKWVVSKLVKHHNHQLK 298
                  9*********************************************9****************************************95 PP

3FAR190.32.6e-28348436289
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk.tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                  fY +Y+++vGF++r+s+ ++skr+++i++r fvCskeg+ ++++   + k +r+r+ tr+gCka+l+vkk+++gkw v+k+e++HnH+l
  Aco028201.1 348 FYFAYSRRVGFNMRVSTYYRSKRDRSIISRLFVCSKEGFYTKKDAGsEGKIKRPREATRVGCKAMLMVKKTTSGKWFVSKFEKDHNHPL 436
                  9**************************************99988774678899**********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2657146IPR004330FAR1 DNA binding domain
PfamPF031013.1E-27210297IPR004330FAR1 DNA binding domain
PfamPF031013.2E-26348436IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MERFMFSTPM IISPVDVEPQ IGDVDELIET SVNRELFEPI VEPYEGMEFD SEEAAKEFYN  60
AYATQMGFKA RISSFIRSKR DKTIISRQLV CSREGFRSTK DASIEGRTKR PRMITRVGCR  120
AMIMVKKQSS GKWIITKCEK IHNHVLGTQG KVEMLGYDPY SCEEERNGKD KLGGAVGNAQ  180
EMLSVLPEGE PGLEPHEGME FESEQEAQLF YKEYARRVGF RARVSSYYRS KRDNSIISRL  240
IVCSKEGFRA KKDENGEELQ RPRAITRVGC KAMIMVKKRD SGKWVVSKLV KHHNHQLKLP  300
ASSDDDHSNA EDDDMIGIEK VLGAQDGTGF IEPYEGLEFE SEEASKIFYF AYSRRVGFNM  360
RVSTYYRSKR DRSIISRLFV CSKEGFYTKK DAGSEGKIKR PREATRVGCK AMLMVKKTTS  420
GKWFVSKFEK DHNHPLGSLR KARKLQKHLS NDSKSASQIE LHHSSQESLT SRYNKLCQEA  480
MKYAEAGAAS PDVYNVAMCA LKEAVKKVTA IKKNNGASKL GLVSSGGNEN IQQLEYSFPF  540
SQRSRKRKTS PSSQSQLSRK KLPRKLRICN TCKNAAEHTS RNCPKKQLNI VSSGAVHAFS  600
HEPSDELIQQ DN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1543548SRKRKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918724.10.0PREDICTED: uncharacterized protein LOC105043030
TrEMBLM0S6Q00.0M0S6Q0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P10090_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90313345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.15e-44FAR1-related sequence 7